AKR1A1,ALR,DD3
  • AKR1A1,ALR,DD3

Anti-AKR1A1 Antibody 100ul

Ref: AN-HPA019649-100ul
Anti-AKR1A1

Información del producto

Polyclonal Antibody against Human AKR1A1, Gene description: aldo-keto reductase family 1, member A1 (aldehyde reductase), Alternative Gene Names: ALR, DD3, Validated applications: ICC, IHC, WB, Uniprot ID: P14550, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name AKR1A1
Gene Description aldo-keto reductase family 1, member A1 (aldehyde reductase)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence NPFPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAH
Immunogen NPFPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ALR, DD3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P14550
HTS Code 3002150000
Gene ID 10327
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-AKR1A1 Antibody 100ul

Anti-AKR1A1 Antibody 100ul