LPAR2,EDG-4,EDG4
  • LPAR2,EDG-4,EDG4

Anti-LPAR2 Antibody 25ul

Ref: AN-HPA019616-25ul
Anti-LPAR2

Información del producto

Polyclonal Antibody against Human LPAR2, Gene description: lysophosphatidic acid receptor 2, Alternative Gene Names: EDG-4, EDG4, LPA2, Validated applications: IHC, Uniprot ID: Q9HBW0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LPAR2
Gene Description lysophosphatidic acid receptor 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDAEMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL
Immunogen LLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDAEMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EDG-4, EDG4, LPA2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HBW0
HTS Code 3002150000
Gene ID 9170
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LPAR2 Antibody 25ul

Anti-LPAR2 Antibody 25ul