UPF1,HUPF1,KIAA0221
  • UPF1,HUPF1,KIAA0221

Anti-UPF1 Antibody 100ul

Ref: AN-HPA019587-100ul
Anti-UPF1

Información del producto

Polyclonal Antibody against Human UPF1, Gene description: UPF1 regulator of nonsense transcripts homolog (yeast), Alternative Gene Names: HUPF1, KIAA0221, NORF1, pNORF1, RENT1, smg-2, Validated applications: ICC, IHC, WB, Uniprot ID: Q92900, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name UPF1
Gene Description UPF1 regulator of nonsense transcripts homolog (yeast)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence LEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTD
Immunogen LEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HUPF1, KIAA0221, NORF1, pNORF1, RENT1, smg-2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92900
HTS Code 3002150000
Gene ID 5976
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-UPF1 Antibody 100ul

Anti-UPF1 Antibody 100ul