TVP23B,CGI-148
  • TVP23B,CGI-148

Anti-TVP23B Antibody 25ul

Ref: AN-HPA019585-25ul
Anti-TVP23B

Información del producto

Polyclonal Antibody against Human TVP23B, Gene description: trans-golgi network vesicle protein 23 homolog B (S. cerevisiae), Alternative Gene Names: CGI-148, FAM18B, FAM18B1, YDR084C, Validated applications: ICC, IHC, Uniprot ID: Q9NYZ1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TVP23B
Gene Description trans-golgi network vesicle protein 23 homolog B (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence RCKVRSRKHLTSMATSYFGKQFLRQNTGDDQTS
Immunogen RCKVRSRKHLTSMATSYFGKQFLRQNTGDDQTS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-148, FAM18B, FAM18B1, YDR084C
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NYZ1
HTS Code 3002150000
Gene ID 51030
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TVP23B Antibody 25ul

Anti-TVP23B Antibody 25ul