SLIT2,SLIL3,Slit-2
  • SLIT2,SLIL3,Slit-2

Anti-SLIT2 Antibody 100ul

Ref: AN-HPA019511-100ul
Anti-SLIT2

Información del producto

Polyclonal Antibody against Human SLIT2, Gene description: slit homolog 2 (Drosophila), Alternative Gene Names: SLIL3, Slit-2, Validated applications: IHC, Uniprot ID: O94813, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLIT2
Gene Description slit homolog 2 (Drosophila)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SAIYSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITNLSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGRIWN
Immunogen SAIYSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITNLSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGRIWN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names SLIL3, Slit-2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O94813
HTS Code 3002150000
Gene ID 9353
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SLIT2 Antibody 100ul

Anti-SLIT2 Antibody 100ul