MINDY4,C7orf67
  • MINDY4,C7orf67

Anti-MINDY4 Antibody 25ul

Ref: AN-HPA019475-25ul
Anti-MINDY4

Información del producto

Polyclonal Antibody against Human MINDY4, Gene description: MINDY lysine 48 deubiquitinase 4, Alternative Gene Names: C7orf67, FAM188B, FLJ22374, Validated applications: IHC, Uniprot ID: Q4G0A6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MINDY4
Gene Description MINDY lysine 48 deubiquitinase 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TTLVNIYDLSDEDAGWRTSLSETSKARHDNLDGDVLGNFVSSKRPPHKSKPMQTVPGETPVLTSAWEKIDKLHSEPSLDVKRMGENSRPKSGLIV
Immunogen TTLVNIYDLSDEDAGWRTSLSETSKARHDNLDGDVLGNFVSSKRPPHKSKPMQTVPGETPVLTSAWEKIDKLHSEPSLDVKRMGENSRPKSGLIV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C7orf67, FAM188B, FLJ22374
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q4G0A6
HTS Code 3002150000
Gene ID 84182
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MINDY4 Antibody 25ul

Anti-MINDY4 Antibody 25ul