ARL6,BBS3,RP55
  • ARL6,BBS3,RP55

Anti-ARL6 Antibody 100ul

Ref: AN-HPA019361-100ul
Anti-ARL6

Información del producto

Polyclonal Antibody against Human ARL6, Gene description: ADP-ribosylation factor-like 6, Alternative Gene Names: BBS3, RP55, Validated applications: IHC, WB, Uniprot ID: Q9H0F7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ARL6
Gene Description ADP-ribosylation factor-like 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence FVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTV
Immunogen FVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BBS3, RP55
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H0F7
HTS Code 3002150000
Gene ID 84100
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ARL6 Antibody 100ul

Anti-ARL6 Antibody 100ul