DSCAM,CHD2-42
  • DSCAM,CHD2-42

Anti-DSCAM Antibody 25ul

Ref: AN-HPA019324-25ul
Anti-DSCAM

Información del producto

Polyclonal Antibody against Human DSCAM, Gene description: Down syndrome cell adhesion molecule, Alternative Gene Names: CHD2-42, CHD2-52, Validated applications: ICC, IHC, Uniprot ID: O60469, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DSCAM
Gene Description Down syndrome cell adhesion molecule
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence PRAQLLIEERDTMETIDDRSTVLLTDADFGEAAKQKSLTVTHTVHYQSVSQATGPLVDVSDARPGTNPTTRRNAKAGPTARNRYASQWTLNRPHPTISAHTLTTDWRLPTPRAAGSVDKESDSYSVSPSQDTDRARSS
Immunogen PRAQLLIEERDTMETIDDRSTVLLTDADFGEAAKQKSLTVTHTVHYQSVSQATGPLVDVSDARPGTNPTTRRNAKAGPTARNRYASQWTLNRPHPTISAHTLTTDWRLPTPRAAGSVDKESDSYSVSPSQDTDRARSS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CHD2-42, CHD2-52
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60469
HTS Code 3002150000
Gene ID 1826
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DSCAM Antibody 25ul

Anti-DSCAM Antibody 25ul