NME8,CILD6,NM23-H8
  • NME8,CILD6,NM23-H8

Anti-NME8 Antibody 25ul

Ref: AN-HPA019259-25ul
Anti-NME8

Información del producto

Polyclonal Antibody against Human NME8, Gene description: NME/NM23 family member 8, Alternative Gene Names: CILD6, NM23-H8, SPTRX2, TXNDC3, Validated applications: IHC, WB, Uniprot ID: Q8N427, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NME8
Gene Description NME/NM23 family member 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence AQLCDIEEDAANVAKFMDAFFPDFKKMKSMKLEKTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQVVLSEKEAQALCKEYENED
Immunogen AQLCDIEEDAANVAKFMDAFFPDFKKMKSMKLEKTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQVVLSEKEAQALCKEYENED
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CILD6, NM23-H8, SPTRX2, TXNDC3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N427
HTS Code 3002150000
Gene ID 51314
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NME8 Antibody 25ul

Anti-NME8 Antibody 25ul