MCOLN2,FLJ36691
  • MCOLN2,FLJ36691

Anti-MCOLN2 Antibody 100ul

Ref: AN-HPA019114-100ul
Anti-MCOLN2

Información del producto

Polyclonal Antibody against Human MCOLN2, Gene description: mucolipin 2, Alternative Gene Names: FLJ36691, TRP-ML2, TRPML2, Validated applications: ICC, IHC, Uniprot ID: Q8IZK6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MCOLN2
Gene Description mucolipin 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence YHQLKDITLGTLGYGENEDNRIGLKVCKQHYKKGTMFPSNETLNIDNDVELDCVQLDLQDLSKKPPDWKNSSFFRLEFYR
Immunogen YHQLKDITLGTLGYGENEDNRIGLKVCKQHYKKGTMFPSNETLNIDNDVELDCVQLDLQDLSKKPPDWKNSSFFRLEFYR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ36691, TRP-ML2, TRPML2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IZK6
HTS Code 3002150000
Gene ID 255231
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MCOLN2 Antibody 100ul

Anti-MCOLN2 Antibody 100ul