SLC45A3,IPCA-2
  • SLC45A3,IPCA-2

Anti-SLC45A3 Antibody 100ul

Ref: AN-HPA019075-100ul
Anti-SLC45A3

Información del producto

Polyclonal Antibody against Human SLC45A3, Gene description: solute carrier family 45, member 3, Alternative Gene Names: IPCA-2, IPCA-6, IPCA-8, PCANAP2, PCANAP6, PCANAP8, prostein, Validated applications: ICC, IHC, Uniprot ID: Q96JT2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLC45A3
Gene Description solute carrier family 45, member 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence PKYRGDTGGASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEP
Immunogen PKYRGDTGGASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IPCA-2, IPCA-6, IPCA-8, PCANAP2, PCANAP6, PCANAP8, prostein
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96JT2
HTS Code 3002150000
Gene ID 85414
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SLC45A3 Antibody 100ul

Anti-SLC45A3 Antibody 100ul