CDKN2C,INK4C,p18
  • CDKN2C,INK4C,p18

Anti-CDKN2C Antibody 100ul

Ref: AN-HPA019057-100ul
Anti-CDKN2C

Información del producto

Polyclonal Antibody against Human CDKN2C, Gene description: cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4), Alternative Gene Names: INK4C, p18, Validated applications: IHC, WB, Uniprot ID: P42773, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CDKN2C
Gene Description cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence LQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANG
Immunogen LQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names INK4C, p18
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P42773
HTS Code 3002150000
Gene ID 1031
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CDKN2C Antibody 100ul

Anti-CDKN2C Antibody 100ul