ZNHIT1,CG1I
  • ZNHIT1,CG1I

Anti-ZNHIT1 Antibody 100ul

Ref: AN-HPA019043-100ul
Anti-ZNHIT1

Información del producto

Polyclonal Antibody against Human ZNHIT1, Gene description: zinc finger, HIT-type containing 1, Alternative Gene Names: CG1I, H_DJ0747G18.14, ZNFN4A1, Validated applications: ICC, IHC, WB, Uniprot ID: O43257, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZNHIT1
Gene Description zinc finger, HIT-type containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, WB, IHC
Sequence TSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKK
Immunogen TSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CG1I, H_DJ0747G18.14, ZNFN4A1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43257
HTS Code 3002150000
Gene ID 10467
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZNHIT1 Antibody 100ul

Anti-ZNHIT1 Antibody 100ul