TUFM,EF-TuMT,EFTu
  • TUFM,EF-TuMT,EFTu

Anti-TUFM Antibody 100ul

Ref: AN-HPA018991-100ul
Anti-TUFM

Información del producto

Polyclonal Antibody against Human TUFM, Gene description: Tu translation elongation factor, mitochondrial, Alternative Gene Names: EF-TuMT, EFTu, Validated applications: ICC, IHC, WB, Uniprot ID: P49411, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TUFM
Gene Description Tu translation elongation factor, mitochondrial
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence LSKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAMTEEEKNIKWG
Immunogen LSKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAMTEEEKNIKWG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EF-TuMT, EFTu
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P49411
HTS Code 3002150000
Gene ID 7284
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TUFM Antibody 100ul

Anti-TUFM Antibody 100ul