PPP2R1B,PP2A-Abeta
  • PPP2R1B,PP2A-Abeta

Anti-PPP2R1B Antibody 25ul

Ref: AN-HPA018908-25ul
Anti-PPP2R1B

Información del producto

Polyclonal Antibody against Human PPP2R1B, Gene description: protein phosphatase 2, regulatory subunit A, beta, Alternative Gene Names: PP2A-Abeta, PR65B, Validated applications: ICC, IHC, WB, Uniprot ID: P30154, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PPP2R1B
Gene Description protein phosphatase 2, regulatory subunit A, beta
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence NALQGEVKPVLQKLGQDEDMDVKYFAQEAISVVAQRLRKLEFPVKDSGEPSVPRADKNHFPRPTVPGEDMGKGPVYQLRGDTRDTLAQLGIAELVHFSQSTD
Immunogen NALQGEVKPVLQKLGQDEDMDVKYFAQEAISVVAQRLRKLEFPVKDSGEPSVPRADKNHFPRPTVPGEDMGKGPVYQLRGDTRDTLAQLGIAELVHFSQSTD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PP2A-Abeta, PR65B
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P30154
HTS Code 3002150000
Gene ID 5519
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PPP2R1B Antibody 25ul

Anti-PPP2R1B Antibody 25ul