CES2,CE-2,CES2A1,iCE
  • CES2,CE-2,CES2A1,iCE

Anti-CES2 Antibody 100ul

Ref: AN-HPA018897-100ul
Anti-CES2

Información del producto

Polyclonal Antibody against Human CES2, Gene description: carboxylesterase 2, Alternative Gene Names: CE-2, CES2A1, iCE, Validated applications: ICC, IHC, WB, Uniprot ID: O00748, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CES2
Gene Description carboxylesterase 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence PVPSIVGVNNNEFGWLIPKVMRIYDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPALQVAHFQCSRAPVYFYEFQHQP
Immunogen PVPSIVGVNNNEFGWLIPKVMRIYDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPALQVAHFQCSRAPVYFYEFQHQP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CE-2, CES2A1, iCE
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00748
HTS Code 3002150000
Gene ID 8824
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CES2 Antibody 100ul

Anti-CES2 Antibody 100ul