NKAIN3,FAM77D
  • NKAIN3,FAM77D

Anti-NKAIN3 Antibody 100ul

Ref: AN-HPA018833-100ul
Anti-NKAIN3

Información del producto

Polyclonal Antibody against Human NKAIN3, Gene description: Na+/K+ transporting ATPase interacting 3, Alternative Gene Names: FAM77D, FLJ39630, Validated applications: IHC, Uniprot ID: Q8N8D7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NKAIN3
Gene Description Na+/K+ transporting ATPase interacting 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SKDTDLMTFNISVHRSWWREHGPGCVRRVLPPSAHGMMDDYTYVSVTGCIVDFQYLEV
Immunogen SKDTDLMTFNISVHRSWWREHGPGCVRRVLPPSAHGMMDDYTYVSVTGCIVDFQYLEV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FAM77D, FLJ39630
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N8D7
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NKAIN3 Antibody 100ul

Anti-NKAIN3 Antibody 100ul