ELMO2,CED-12,CED12
  • ELMO2,CED-12,CED12

Anti-ELMO2 Antibody 25ul

Ref: AN-HPA018811-25ul
Anti-ELMO2

Información del producto

Polyclonal Antibody against Human ELMO2, Gene description: engulfment and cell motility 2, Alternative Gene Names: CED-12, CED12, ELMO-2, FLJ11656, KIAA1834, Validated applications: ICC, Uniprot ID: Q96JJ3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ELMO2
Gene Description engulfment and cell motility 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence CDGWSLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSAD
Immunogen CDGWSLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSAD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CED-12, CED12, ELMO-2, FLJ11656, KIAA1834
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96JJ3
HTS Code 3002150000
Gene ID 63916
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ELMO2 Antibody 25ul

Anti-ELMO2 Antibody 25ul