RASGRF2,GRF2
  • RASGRF2,GRF2

Anti-RASGRF2 Antibody 100ul

Ref: AN-HPA018679-100ul
Anti-RASGRF2

Información del producto

Polyclonal Antibody against Human RASGRF2, Gene description: Ras protein-specific guanine nucleotide-releasing factor 2, Alternative Gene Names: GRF2, Ras-GRF2, Validated applications: IHC, Uniprot ID: O14827, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RASGRF2
Gene Description Ras protein-specific guanine nucleotide-releasing factor 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence FATSQNNRGEHLVDGKSPRLCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSKIGALDLTTSSSPTTTTQSPAASPPPHTGQIPLDLSRGLSSPEQSPGTVEENVD
Immunogen FATSQNNRGEHLVDGKSPRLCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSKIGALDLTTSSSPTTTTQSPAASPPPHTGQIPLDLSRGLSSPEQSPGTVEENVD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GRF2, Ras-GRF2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14827
HTS Code 3002150000
Gene ID 5924
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RASGRF2 Antibody 100ul

Anti-RASGRF2 Antibody 100ul