SLC38A6,NAT-1
  • SLC38A6,NAT-1

Anti-SLC38A6 Antibody 25ul

Ref: AN-HPA018508-25ul
Anti-SLC38A6

Información del producto

Polyclonal Antibody against Human SLC38A6, Gene description: solute carrier family 38, member 6, Alternative Gene Names: NAT-1, Validated applications: ICC, IHC, Uniprot ID: Q8IZM9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SLC38A6
Gene Description solute carrier family 38, member 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence KWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESA
Immunogen KWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NAT-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IZM9
HTS Code 3002150000
Gene ID 145389
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SLC38A6 Antibody 25ul

Anti-SLC38A6 Antibody 25ul