TMED1,Il1rl1l
  • TMED1,Il1rl1l

Anti-TMED1 Antibody 100ul

Ref: AN-HPA018507-100ul
Anti-TMED1

Información del producto

Polyclonal Antibody against Human TMED1, Gene description: transmembrane emp24 protein transport domain containing 1, Alternative Gene Names: Il1rl1l, IL1RL1LG, MGC1270, ST2L, Validated applications: IHC, WB, Uniprot ID: Q13445, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TMED1
Gene Description transmembrane emp24 protein transport domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence PPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDFTLESPQGVLLVSESRKADG
Immunogen PPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDFTLESPQGVLLVSESRKADG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Il1rl1l, IL1RL1LG, MGC1270, ST2L
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13445
HTS Code 3002150000
Gene ID 11018
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TMED1 Antibody 100ul

Anti-TMED1 Antibody 100ul