CSRNP2,C12ORF2
  • CSRNP2,C12ORF2

Anti-CSRNP2 Antibody 25ul

Ref: AN-HPA018503-25ul
Anti-CSRNP2

Información del producto

Polyclonal Antibody against Human CSRNP2, Gene description: cysteine-serine-rich nuclear protein 2, Alternative Gene Names: C12ORF2, C12orf22, FAM130A1, PPP1R72, TAIP-12, Validated applications: IHC, WB, Uniprot ID: Q9H175, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CSRNP2
Gene Description cysteine-serine-rich nuclear protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence FNPIRVRTHYLHTIMKLELESKRQVSRPAAPDEEPSPTASCSLTGAQGSETQDFQEFIAENETAVMHLQSAEELERLKAEEDSSGSSAS
Immunogen FNPIRVRTHYLHTIMKLELESKRQVSRPAAPDEEPSPTASCSLTGAQGSETQDFQEFIAENETAVMHLQSAEELERLKAEEDSSGSSAS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C12ORF2, C12orf22, FAM130A1, PPP1R72, TAIP-12
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H175
HTS Code 3002150000
Gene ID 81566
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CSRNP2 Antibody 25ul

Anti-CSRNP2 Antibody 25ul