USP4,UNP,Unph
  • USP4,UNP,Unph

Anti-USP4 Antibody 100ul

Ref: AN-HPA018499-100ul
Anti-USP4

Información del producto

Polyclonal Antibody against Human USP4, Gene description: ubiquitin specific peptidase 4 (proto-oncogene), Alternative Gene Names: UNP, Unph, Validated applications: ICC, IHC, WB, Uniprot ID: Q13107, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name USP4
Gene Description ubiquitin specific peptidase 4 (proto-oncogene)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence NMVVADVYNHRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPL
Immunogen NMVVADVYNHRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names UNP, Unph
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13107
HTS Code 3002150000
Gene ID 7375
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-USP4 Antibody 100ul

Anti-USP4 Antibody 100ul