PDP1,PDH,PDP,PPM2C
  • PDP1,PDH,PDP,PPM2C

Anti-PDP1 Antibody 25ul

Ref: AN-HPA018483-25ul
Anti-PDP1

Información del producto

Polyclonal Antibody against Human PDP1, Gene description: pyruvate dehyrogenase phosphatase catalytic subunit 1, Alternative Gene Names: PDH, PDP, PPM2C, Validated applications: IHC, WB, Uniprot ID: Q9P0J1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PDP1
Gene Description pyruvate dehyrogenase phosphatase catalytic subunit 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence YLTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLLGVFDGHAGCACSQ
Immunogen YLTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLLGVFDGHAGCACSQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PDH, PDP, PPM2C
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P0J1
HTS Code 3002150000
Gene ID 54704
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PDP1 Antibody 25ul

Anti-PDP1 Antibody 25ul