IL16,FLJ16806
  • IL16,FLJ16806

Anti-IL16 Antibody 25ul

Ref: AN-HPA018467-25ul
Anti-IL16

Información del producto

Polyclonal Antibody against Human IL16, Gene description: interleukin 16, Alternative Gene Names: FLJ16806, FLJ42735, HsT19289, IL-16, LCF, prIL-16, Validated applications: ICC, IHC, Uniprot ID: Q14005, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name IL16
Gene Description interleukin 16
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence QRARSFPLTRSQSCETKLLDEKTSKLYSISSQVSSAVMKSLLCLPSSISCAQTPCIPKEGASPTSSSNEDSAANGSAETSALDTGFSLNLSELREYTEGLTEAKEDDDG
Immunogen QRARSFPLTRSQSCETKLLDEKTSKLYSISSQVSSAVMKSLLCLPSSISCAQTPCIPKEGASPTSSSNEDSAANGSAETSALDTGFSLNLSELREYTEGLTEAKEDDDG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ16806, FLJ42735, HsT19289, IL-16, LCF, prIL-16
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14005
HTS Code 3002150000
Gene ID 3603
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IL16 Antibody 25ul

Anti-IL16 Antibody 25ul