MRPL39,C21orf92
  • MRPL39,C21orf92

Anti-MRPL39 Antibody 25ul

Ref: AN-HPA018331-25ul
Anti-MRPL39

Información del producto

Polyclonal Antibody against Human MRPL39, Gene description: mitochondrial ribosomal protein L39, Alternative Gene Names: C21orf92, FLJ20451, L39mt, MGC104174, MGC3400, MRP-L5, MSTP003, PRED22, PRED66, RPML5, Validated applications: IHC, WB, Uniprot ID: Q9NYK5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MRPL39
Gene Description mitochondrial ribosomal protein L39
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence ERIVKLHRIGDFIDVSEGPLIPRTSICFQYEVSAVHNLQPTQPSLIRRFQGVSLPVHLRAHFTIWDKLLERSRKMVTEDQSKAT
Immunogen ERIVKLHRIGDFIDVSEGPLIPRTSICFQYEVSAVHNLQPTQPSLIRRFQGVSLPVHLRAHFTIWDKLLERSRKMVTEDQSKAT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C21orf92, FLJ20451, L39mt, MGC104174, MGC3400, MRP-L5, MSTP003, PRED22, PRED66, RPML5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NYK5
HTS Code 3002150000
Gene ID 54148
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MRPL39 Antibody 25ul

Anti-MRPL39 Antibody 25ul