MIS18A,B28,C21orf45
  • MIS18A,B28,C21orf45

Anti-MIS18A Antibody 100ul

Ref: AN-HPA018286-100ul
Anti-MIS18A

Información del producto

Polyclonal Antibody against Human MIS18A, Gene description: MIS18 kinetochore protein A, Alternative Gene Names: B28, C21orf45, C21orf46, FASP1, hMis18alpha, Validated applications: IHC, Uniprot ID: Q9NYP9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MIS18A
Gene Description MIS18 kinetochore protein A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KNLDYKRDLFCLSVEAIESYVLGSSEKQIVSEDKELFNLESRVEIEKSLTQMEDVLKALQMKLWEAESKLSFATC
Immunogen KNLDYKRDLFCLSVEAIESYVLGSSEKQIVSEDKELFNLESRVEIEKSLTQMEDVLKALQMKLWEAESKLSFATC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B28, C21orf45, C21orf46, FASP1, hMis18alpha
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NYP9
HTS Code 3002150000
Gene ID 54069
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MIS18A Antibody 100ul

Anti-MIS18A Antibody 100ul