SLC30A4,ZNT4
  • SLC30A4,ZNT4

Anti-SLC30A4 Antibody 25ul

Ref: AN-HPA018178-25ul
Anti-SLC30A4

Información del producto

Polyclonal Antibody against Human SLC30A4, Gene description: solute carrier family 30 (zinc transporter), member 4, Alternative Gene Names: ZNT4, Validated applications: IHC, Uniprot ID: O14863, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SLC30A4
Gene Description solute carrier family 30 (zinc transporter), member 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PSHLNVDYIKEALMKIEDVYSVEDLNIWSLTSGKSTAIVHIQLIPGSSSKWEEVQSKANHLLLNTFGMYRCTIQLQSYRQEVDRTCANCQ
Immunogen PSHLNVDYIKEALMKIEDVYSVEDLNIWSLTSGKSTAIVHIQLIPGSSSKWEEVQSKANHLLLNTFGMYRCTIQLQSYRQEVDRTCANCQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ZNT4
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14863
HTS Code 3002150000
Gene ID 7782
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SLC30A4 Antibody 25ul

Anti-SLC30A4 Antibody 25ul