ZNHIT6,BCD1
  • ZNHIT6,BCD1

Anti-ZNHIT6 Antibody 25ul

Ref: AN-HPA018132-25ul
Anti-ZNHIT6

Información del producto

Polyclonal Antibody against Human ZNHIT6, Gene description: zinc finger, HIT-type containing 6, Alternative Gene Names: BCD1, C1orf181, FLJ20729, NY-BR-75, Validated applications: ICC, IHC, WB, Uniprot ID: Q9NWK9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZNHIT6
Gene Description zinc finger, HIT-type containing 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC, IHC
Sequence KEELMHGECVKEEKDFLKKEIVDDTKVKEEPPINHPVGCKRKLAMSRCETCGTEEAKYRCPRCMRYSCSLPCVKKHKAELTCNGVRDKTAYISIQQFTEMNLL
Immunogen KEELMHGECVKEEKDFLKKEIVDDTKVKEEPPINHPVGCKRKLAMSRCETCGTEEAKYRCPRCMRYSCSLPCVKKHKAELTCNGVRDKTAYISIQQFTEMNLL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BCD1, C1orf181, FLJ20729, NY-BR-75
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NWK9
HTS Code 3002150000
Gene ID 54680
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZNHIT6 Antibody 25ul

Anti-ZNHIT6 Antibody 25ul