NAV1,DKFZp781D0314
  • NAV1,DKFZp781D0314

Anti-NAV1 Antibody 25ul

Ref: AN-HPA018127-25ul
Anti-NAV1

Información del producto

Polyclonal Antibody against Human NAV1, Gene description: neuron navigator 1, Alternative Gene Names: DKFZp781D0314, FLJ12560, FLJ14203, KIAA1151, MGC14961, POMFIL3, steerin-1, Validated applications: IHC, Uniprot ID: Q8NEY1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NAV1
Gene Description neuron navigator 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RETMHNMQLEVDLLKAENDRLKVAPGPSSGSTPGQVPGSSALSSPRRSLGLALTHSFGPSLADTDLSPMDGISTCGPKEEVTLRVVVRMPPQHIIKGDLKQQEFFLGCSKVSGKVDWKMLDEAVFQVFKDYISKMDPASTLGLSTESIH
Immunogen RETMHNMQLEVDLLKAENDRLKVAPGPSSGSTPGQVPGSSALSSPRRSLGLALTHSFGPSLADTDLSPMDGISTCGPKEEVTLRVVVRMPPQHIIKGDLKQQEFFLGCSKVSGKVDWKMLDEAVFQVFKDYISKMDPASTLGLSTESIH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp781D0314, FLJ12560, FLJ14203, KIAA1151, MGC14961, POMFIL3, steerin-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NEY1
HTS Code 3002150000
Gene ID 89796
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NAV1 Antibody 25ul

Anti-NAV1 Antibody 25ul