HTR1A,5-HT1A
  • HTR1A,5-HT1A

Anti-HTR1A Antibody 25ul

Ref: AN-HPA018073-25ul
Anti-HTR1A

Información del producto

Polyclonal Antibody against Human HTR1A, Gene description: 5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled, Alternative Gene Names: 5-HT1A, ADRB2RL1, ADRBRL1, Validated applications: IHC, Uniprot ID: P08908, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HTR1A
Gene Description 5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VEKTGADTRHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALA
Immunogen VEKTGADTRHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 5-HT1A, ADRB2RL1, ADRBRL1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P08908
HTS Code 3002150000
Gene ID 3350
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HTR1A Antibody 25ul

Anti-HTR1A Antibody 25ul