FZD6,Hfz6
  • FZD6,Hfz6

Anti-FZD6 Antibody 100ul

Ref: AN-HPA017991-100ul
Anti-FZD6

Información del producto

Polyclonal Antibody against Human FZD6, Gene description: frizzled class receptor 6, Alternative Gene Names: Hfz6, Validated applications: ICC, IHC, WB, Uniprot ID: O60353, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FZD6
Gene Description frizzled class receptor 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence TSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSGEQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVS
Immunogen TSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSGEQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Hfz6
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60353
HTS Code 3002150000
Gene ID 8323
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FZD6 Antibody 100ul

Anti-FZD6 Antibody 100ul