MFAP3L,KIAA0626
  • MFAP3L,KIAA0626

Anti-MFAP3L Antibody 25ul

Ref: AN-HPA017986-25ul
Anti-MFAP3L

Información del producto

Polyclonal Antibody against Human MFAP3L, Gene description: microfibrillar-associated protein 3-like, Alternative Gene Names: KIAA0626, NYD-sp9, Validated applications: IHC, Uniprot ID: O75121, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MFAP3L
Gene Description microfibrillar-associated protein 3-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TNSTLNGTNVVLGSVPVIIARTDHIIVKEGNSALINCSVYGIPDPQFKWYNSIGKLLKEEEDEKERGGGKWQMHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGD
Immunogen TNSTLNGTNVVLGSVPVIIARTDHIIVKEGNSALINCSVYGIPDPQFKWYNSIGKLLKEEEDEKERGGGKWQMHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0626, NYD-sp9
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75121
HTS Code 3002150000
Gene ID 9848
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MFAP3L Antibody 25ul

Anti-MFAP3L Antibody 25ul