SPAM1,HYAL5,PH-20
  • SPAM1,HYAL5,PH-20

Anti-SPAM1 Antibody 100ul

Ref: AN-HPA017984-100ul
Anti-SPAM1

Información del producto

Polyclonal Antibody against Human SPAM1, Gene description: sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding), Alternative Gene Names: HYAL5, PH-20, SPAG15, Validated applications: IHC, Uniprot ID: P38567, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SPAM1
Gene Description sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence CLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSSDYLHLNPDNFAIQLEKGGKFTVRGKPTLEDLEQFSEKFYCSCYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPM
Immunogen CLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSSDYLHLNPDNFAIQLEKGGKFTVRGKPTLEDLEQFSEKFYCSCYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HYAL5, PH-20, SPAG15
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P38567
HTS Code 3002150000
Gene ID 6677
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SPAM1 Antibody 100ul

Anti-SPAM1 Antibody 100ul