DHCR24,DCE,KIAA0018
  • DHCR24,DCE,KIAA0018

Anti-DHCR24 Antibody 25ul

Ref: AN-HPA017981-25ul
Anti-DHCR24

Información del producto

Polyclonal Antibody against Human DHCR24, Gene description: 24-dehydrocholesterol reductase, Alternative Gene Names: DCE, KIAA0018, seladin-1, Validated applications: IHC, Uniprot ID: Q15392, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DHCR24
Gene Description 24-dehydrocholesterol reductase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SKLNSIGNYYKPWFFKHVENYLKTNREGLEYIPLRHYYHRHTRSIFWELQDIIPFGNNPIFRYLFGWMVPPKISLLKLTQGETLRKLYEQHHVVQDMLVPMKCLQQALHTFQNDIHVYPIWLCPFILPSQPGLVHPKG
Immunogen SKLNSIGNYYKPWFFKHVENYLKTNREGLEYIPLRHYYHRHTRSIFWELQDIIPFGNNPIFRYLFGWMVPPKISLLKLTQGETLRKLYEQHHVVQDMLVPMKCLQQALHTFQNDIHVYPIWLCPFILPSQPGLVHPKG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DCE, KIAA0018, seladin-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15392
HTS Code 3002150000
Gene ID 1718
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DHCR24 Antibody 25ul

Anti-DHCR24 Antibody 25ul