LRRC8B,KIAA0231
  • LRRC8B,KIAA0231

Anti-LRRC8B Antibody 25ul

Ref: AN-HPA017950-25ul
Anti-LRRC8B

Información del producto

Polyclonal Antibody against Human LRRC8B, Gene description: leucine rich repeat containing 8 family, member B, Alternative Gene Names: KIAA0231, TA-LRRP, Validated applications: ICC, IHC, Uniprot ID: Q6P9F7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LRRC8B
Gene Description leucine rich repeat containing 8 family, member B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSSSGCSADIDSGKQSLPYPQPGLESAGIESPTSSVLDKKEGEQAKAIFEKVKRFRMHVEQKD
Immunogen PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSSSGCSADIDSGKQSLPYPQPGLESAGIESPTSSVLDKKEGEQAKAIFEKVKRFRMHVEQKD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0231, TA-LRRP
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6P9F7
HTS Code 3002150000
Gene ID 23507
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LRRC8B Antibody 25ul

Anti-LRRC8B Antibody 25ul