CIAO1,CIA1,WDR39
  • CIAO1,CIA1,WDR39

Anti-CIAO1 Antibody 25ul

Ref: AN-HPA017882-25ul
Anti-CIAO1

Información del producto

Polyclonal Antibody against Human CIAO1, Gene description: cytosolic iron-sulfur assembly component 1, Alternative Gene Names: CIA1, WDR39, Validated applications: ICC, IHC, WB, Uniprot ID: O76071, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CIAO1
Gene Description cytosolic iron-sulfur assembly component 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence CSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQR
Immunogen CSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CIA1, WDR39
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O76071
HTS Code 3002150000
Gene ID 9391
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CIAO1 Antibody 25ul

Anti-CIAO1 Antibody 25ul