DLC1,ARHGAP7,DLC-1
  • DLC1,ARHGAP7,DLC-1

Anti-DLC1 Antibody 100ul

Ref: AN-HPA017753-100ul
Anti-DLC1

Información del producto

Polyclonal Antibody against Human DLC1, Gene description: DLC1 Rho GTPase activating protein, Alternative Gene Names: ARHGAP7, DLC-1, HP, p122-RhoGAP, STARD12, Validated applications: ICC, IHC, WB, Uniprot ID: Q96QB1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DLC1
Gene Description DLC1 Rho GTPase activating protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence RSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVSLPDCCHGSELRDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLCLTDDKQVLNTQGQ
Immunogen RSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVSLPDCCHGSELRDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLCLTDDKQVLNTQGQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARHGAP7, DLC-1, HP, p122-RhoGAP, STARD12
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96QB1
HTS Code 3002150000
Gene ID 10395
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DLC1 Antibody 100ul

Anti-DLC1 Antibody 100ul