TMEM131,CC28
  • TMEM131,CC28

Anti-TMEM131 Antibody 100ul

Ref: AN-HPA017682-100ul
Anti-TMEM131

Información del producto

Polyclonal Antibody against Human TMEM131, Gene description: transmembrane protein 131, Alternative Gene Names: CC28, KIAA0257, PRO1048, RW1, YR-23, Validated applications: IHC, Uniprot ID: Q92545, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TMEM131
Gene Description transmembrane protein 131
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DFGTLRTQDLPKVLNLHLLNSGTKDVPITSVRPTPQNDAITVHFKPITLKASESKYTKVASISFDASKAKKPSQFSGKITVKAKEKSYSKLEIPYQAEVLDGYLGFDHAATLFHIRDSPADPVERPIYLTNTFSFAIL
Immunogen DFGTLRTQDLPKVLNLHLLNSGTKDVPITSVRPTPQNDAITVHFKPITLKASESKYTKVASISFDASKAKKPSQFSGKITVKAKEKSYSKLEIPYQAEVLDGYLGFDHAATLFHIRDSPADPVERPIYLTNTFSFAIL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CC28, KIAA0257, PRO1048, RW1, YR-23
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92545
HTS Code 3002150000
Gene ID 23505
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TMEM131 Antibody 100ul

Anti-TMEM131 Antibody 100ul