ENTPD4,KIAA0392
  • ENTPD4,KIAA0392

Anti-ENTPD4 Antibody 25ul

Ref: AN-HPA017655-25ul
Anti-ENTPD4

Información del producto

Polyclonal Antibody against Human ENTPD4, Gene description: ectonucleoside triphosphate diphosphohydrolase 4, Alternative Gene Names: KIAA0392, LALP70, LAP70, LYSAL1, NTPDase-4, UDPase, Validated applications: ICC, IHC, WB, Uniprot ID: Q9Y227, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ENTPD4
Gene Description ectonucleoside triphosphate diphosphohydrolase 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence FGGNAARQRYEDRIFANTIQKNRLLGKQTGLTPDMPYLDPCLPLDIKDEIQQNGQTIYLRGTGDFDLCRETIQPFMNKTNETQTSLNGVYQPPIHFQNSEFYGFSEFYYCTEDVLR
Immunogen FGGNAARQRYEDRIFANTIQKNRLLGKQTGLTPDMPYLDPCLPLDIKDEIQQNGQTIYLRGTGDFDLCRETIQPFMNKTNETQTSLNGVYQPPIHFQNSEFYGFSEFYYCTEDVLR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0392, LALP70, LAP70, LYSAL1, NTPDase-4, UDPase
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y227
HTS Code 3002150000
Gene ID 9583
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ENTPD4 Antibody 25ul

Anti-ENTPD4 Antibody 25ul