FIS1,CGI-135,Fis1
  • FIS1,CGI-135,Fis1

Anti-FIS1 Antibody 100ul

Ref: AN-HPA017430-100ul
Anti-FIS1

Información del producto

Polyclonal Antibody against Human FIS1, Gene description: fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae), Alternative Gene Names: CGI-135, Fis1, H_NH0132A01.6, TTC11, Validated applications: ICC, IHC, WB, Uniprot ID: Q9Y3D6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FIS1
Gene Description fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD
Immunogen MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-135, Fis1, H_NH0132A01.6, TTC11
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y3D6
HTS Code 3002150000
Gene ID 51024
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FIS1 Antibody 100ul

Anti-FIS1 Antibody 100ul