IRS4,IRS-4,PY160
  • IRS4,IRS-4,PY160

Anti-IRS4 Antibody 25ul

Ref: AN-HPA017372-25ul
Anti-IRS4

Información del producto

Polyclonal Antibody against Human IRS4, Gene description: insulin receptor substrate 4, Alternative Gene Names: IRS-4, PY160, Validated applications: IHC, Uniprot ID: O14654, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name IRS4
Gene Description insulin receptor substrate 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence NPANDLSDLLRAIPRANPLSLDSARWPLPPLPLSATGSNAIEEEGDYIEVIFNSAMTPAMALADSAIRYDAETGRIYVVDPFSECCMDISLSPSRCSEPPPVARLLQEEEQERRRPQSRSQ
Immunogen NPANDLSDLLRAIPRANPLSLDSARWPLPPLPLSATGSNAIEEEGDYIEVIFNSAMTPAMALADSAIRYDAETGRIYVVDPFSECCMDISLSPSRCSEPPPVARLLQEEEQERRRPQSRSQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IRS-4, PY160
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14654
HTS Code 3002150000
Gene ID 8471
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IRS4 Antibody 25ul

Anti-IRS4 Antibody 25ul