VSTM4,C10orf72
  • VSTM4,C10orf72

Anti-VSTM4 Antibody 25ul

Ref: AN-HPA017279-25ul
Anti-VSTM4

Información del producto

Polyclonal Antibody against Human VSTM4, Gene description: V-set and transmembrane domain containing 4, Alternative Gene Names: C10orf72, FLJ31737, Validated applications: ICC, IHC, Uniprot ID: Q8IW00, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name VSTM4
Gene Description V-set and transmembrane domain containing 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence RVRHYLVKCPQNSSGETVTSVTSLAPLQPKKGKRQKEKPDIPPAVPAKAPIAPTFHKPKLLKPQRKVTLPKIAEENLTYAELELIKPHRAAKGAPTSTVYAQILFE
Immunogen RVRHYLVKCPQNSSGETVTSVTSLAPLQPKKGKRQKEKPDIPPAVPAKAPIAPTFHKPKLLKPQRKVTLPKIAEENLTYAELELIKPHRAAKGAPTSTVYAQILFE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C10orf72, FLJ31737
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IW00
HTS Code 3002150000
Gene ID 196740
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-VSTM4 Antibody 25ul

Anti-VSTM4 Antibody 25ul