GALNT6,GalNAc-T6
  • GALNT6,GalNAc-T6

Anti-GALNT6 Antibody 100ul

Ref: AN-HPA017086-100ul
Anti-GALNT6

Información del producto

Polyclonal Antibody against Human GALNT6, Gene description: polypeptide N-acetylgalactosaminyltransferase 6, Alternative Gene Names: GalNAc-T6, Validated applications: ICC, IHC, WB, Uniprot ID: Q8NCL4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GALNT6
Gene Description polypeptide N-acetylgalactosaminyltransferase 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence PWLKSLVSRKDHVLDLMLEAMNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDPNAPGADGKAFQKSKWTPLETQEKEE
Immunogen PWLKSLVSRKDHVLDLMLEAMNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDPNAPGADGKAFQKSKWTPLETQEKEE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GalNAc-T6
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NCL4
HTS Code 3002150000
Gene ID 11226
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GALNT6 Antibody 100ul

Anti-GALNT6 Antibody 100ul