PTGFRN,CD315,CD9P-1
  • PTGFRN,CD315,CD9P-1

Anti-PTGFRN Antibody 100ul

Ref: AN-HPA017074-100ul
Anti-PTGFRN

Información del producto

Polyclonal Antibody against Human PTGFRN, Gene description: prostaglandin F2 receptor inhibitor, Alternative Gene Names: CD315, CD9P-1, EWI-F, FLJ11001, FPRP, KIAA1436, SMAP-6, Validated applications: IHC, Uniprot ID: Q9P2B2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PTGFRN
Gene Description prostaglandin F2 receptor inhibitor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence NSGYYYCHVSLWAPGHNRSWHKVAEAVSSPAGVGVTWLEPDYQVYLNASKVPGFADDPTELACRVVDTKSGEANVRFTVSWYYRMNRRSDNVVTSELLAVMDGDW
Immunogen NSGYYYCHVSLWAPGHNRSWHKVAEAVSSPAGVGVTWLEPDYQVYLNASKVPGFADDPTELACRVVDTKSGEANVRFTVSWYYRMNRRSDNVVTSELLAVMDGDW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD315, CD9P-1, EWI-F, FLJ11001, FPRP, KIAA1436, SMAP-6
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P2B2
HTS Code 3002150000
Gene ID 5738
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PTGFRN Antibody 100ul

Anti-PTGFRN Antibody 100ul