PNKD,BRP17
  • PNKD,BRP17

Anti-PNKD Antibody 100ul

Ref: AN-HPA017068-100ul
Anti-PNKD

Información del producto

Polyclonal Antibody against Human PNKD, Gene description: paroxysmal nonkinesigenic dyskinesia, Alternative Gene Names: BRP17, DKFZp564N1362, DYT8, FKSG19, FPD1, KIAA1184, KIPP1184, MGC31943, MR-1, PDC, PKND1, TAHCCP2, Validated applications: ICC, IHC, Uniprot ID: Q8N490, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PNKD
Gene Description paroxysmal nonkinesigenic dyskinesia
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence REVDKDRVKQMKARQNMRLSNTGEYESQRFRASSQSAPSPDVGSGVQ
Immunogen REVDKDRVKQMKARQNMRLSNTGEYESQRFRASSQSAPSPDVGSGVQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BRP17, DKFZp564N1362, DYT8, FKSG19, FPD1, KIAA1184, KIPP1184, MGC31943, MR-1, PDC, PKND1, TAHCCP2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N490
HTS Code 3002150000
Gene ID 25953
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PNKD Antibody 100ul

Anti-PNKD Antibody 100ul