ITGB2,CD18,LFA-1
  • ITGB2,CD18,LFA-1

Anti-ITGB2 Antibody 100ul

Ref: AN-HPA016894-100ul
Anti-ITGB2

Información del producto

Polyclonal Antibody against Human ITGB2, Gene description: integrin, beta 2 (complement component 3 receptor 3 and 4 subunit), Alternative Gene Names: CD18, LFA-1, MAC-1, MFI7, Validated applications: ICC, IHC, WB, Uniprot ID: P05107, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ITGB2
Gene Description integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC, IHC
Sequence LEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGV
Immunogen LEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD18, LFA-1, MAC-1, MFI7
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P05107
HTS Code 3002150000
Gene ID 3689
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ITGB2 Antibody 100ul

Anti-ITGB2 Antibody 100ul