PTPN23
  • PTPN23

Anti-PTPN23 Antibody 25ul

Ref: AN-HPA016845-25ul
Anti-PTPN23

Información del producto

Polyclonal Antibody against Human PTPN23, Gene description: protein tyrosine phosphatase, non-receptor type 23, Alternative Gene Names: DKFZP564F0923, HD-PTP, KIAA1471, Validated applications: ICC, IHC, Uniprot ID: Q9H3S7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PTPN23
Gene Description protein tyrosine phosphatase, non-receptor type 23
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence VLDQFMDSMQLDPETVDNLDAYSHIPPQLMEKCAALSVRPDTVRNLVQSMQVLSGVFTDVEASLKDIRDLLEEDELLEQKFQEAVGQAGAISITSKAELAEVRREWAKYMEVHEKASFTNSELHRAMNLHVGN
Immunogen VLDQFMDSMQLDPETVDNLDAYSHIPPQLMEKCAALSVRPDTVRNLVQSMQVLSGVFTDVEASLKDIRDLLEEDELLEQKFQEAVGQAGAISITSKAELAEVRREWAKYMEVHEKASFTNSELHRAMNLHVGN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP564F0923, HD-PTP, KIAA1471
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H3S7
HTS Code 3002150000
Gene ID 25930
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PTPN23 Antibody 25ul

Anti-PTPN23 Antibody 25ul