RRP1,D21S2056E
  • RRP1,D21S2056E

Anti-RRP1 Antibody 100ul

Ref: AN-HPA016818-100ul
Anti-RRP1

Información del producto

Polyclonal Antibody against Human RRP1, Gene description: ribosomal RNA processing 1, Alternative Gene Names: D21S2056E, NNP-1, Nop52, RRP1A, Validated applications: ICC, IHC, WB, Uniprot ID: P56182, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RRP1
Gene Description ribosomal RNA processing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC, WB
Sequence GSICRAEPEAGEEQAGDDRDSGGPVLQFDYEAVANRLFEMASRQSTPSQNRKRLYKVIRKLQDLAGGIFPEDEIPEKACRRLLEGRRQKK
Immunogen GSICRAEPEAGEEQAGDDRDSGGPVLQFDYEAVANRLFEMASRQSTPSQNRKRLYKVIRKLQDLAGGIFPEDEIPEKACRRLLEGRRQKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names D21S2056E, NNP-1, Nop52, RRP1A
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P56182
HTS Code 3002150000
Gene ID 8568
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RRP1 Antibody 100ul

Anti-RRP1 Antibody 100ul