ZBTB20,DKFZp566F123
  • ZBTB20,DKFZp566F123

Anti-ZBTB20 Antibody 25ul

Ref: AN-HPA016815-25ul
Anti-ZBTB20

Información del producto

Polyclonal Antibody against Human ZBTB20, Gene description: zinc finger and BTB domain containing 20, Alternative Gene Names: DKFZp566F123, DPZF, ODA-8S, ZNF288, Validated applications: ICC, IHC, Uniprot ID: Q9HC78, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZBTB20
Gene Description zinc finger and BTB domain containing 20
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence SVEQQFGPGAARDSQAEPTQPEQAAEAPAEGGPQTNQLETGASSPERSNEVEMDSTVITVSNSSDKSVLQQPSVNTSIGQPLPSTQLYLRQTETLTSNLRMPLTLTSNTQVIGTAGNTYLPALFTTQPAGSGPKPFLFSLPQPLAGQQTQ
Immunogen SVEQQFGPGAARDSQAEPTQPEQAAEAPAEGGPQTNQLETGASSPERSNEVEMDSTVITVSNSSDKSVLQQPSVNTSIGQPLPSTQLYLRQTETLTSNLRMPLTLTSNTQVIGTAGNTYLPALFTTQPAGSGPKPFLFSLPQPLAGQQTQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp566F123, DPZF, ODA-8S, ZNF288
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HC78
HTS Code 3002150000
Gene ID 26137
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZBTB20 Antibody 25ul

Anti-ZBTB20 Antibody 25ul